![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species) |
![]() | Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries) |
![]() | Domain d2q4gx_: 2q4g X: [139850] Other proteins in same PDB: d2q4gw_, d2q4gy_ automated match to d1dzaa_ complexed with cit |
PDB Entry: 2q4g (more details), 1.95 Å
SCOPe Domain Sequences for d2q4gx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4gx_ d.5.1.1 (X:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]} esrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqe kvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfd asveds
Timeline for d2q4gx_: