SCOP 1.75: Domain d2q4fa1: 2q4f A:2-143

Lineage for d2q4fa1 (2q4f A:2-143)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Histidine-containing phosphotransfer protein HP1 [140413] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [140414] (2 PDB entries)
   Uniprot Q6VAK4 2-143

8. Domain d2q4fa1: 2q4f A:2-143 [139847]
   automatically matched to 1YVI A:2-143

Details for d2q4fa1

PDB Entry: 2q4f, 2 Å

PDB Description: Ensemble refinement of the crystal structure of putative histidine-containing phosphotransfer protein from rice, Ak104879

PDB Compounds: (A:) Histidine-containing phosphotransfer protein 1

SCOP Domain Sequences for d2q4fa1:

Sequence, based on SEQRES records:

>d2q4fa1 a.24.10.2 (A:2-143) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriinei
atlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvr
ndfydlrnkfqtmlqleqqiqa

Sequence, based on observed residues (ATOM records):

>d2q4fa1 a.24.10.2 (A:2-143) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaaalrdqltallssmfsqglvdeqfqqlqmlqdtpgfvsevvtlfcddadriineiatl
leqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndf
ydlrnkfqtmlqleqqiqa

Timeline for d2q4fa1:

• d2q4fa1 first appeared in SCOP 1.73
  
• d2q4fa1 is called d2q4fa_ in SCOPe 2.01
  
• d2q4fa1 appears in the current release, SCOPe 2.08, called d2q4fa2