Lineage for d2q4db_ (2q4d B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530140Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2530141Superfamily c.129.1: MCP/YpsA-like [102405] (3 families) (S)
  5. 2530142Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
    Pfam PF03641
  6. 2530149Protein Hypothetical protein At5g11950 [117567] (1 species)
  7. 2530150Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries)
    Uniprot Q84MC2
  8. 2530152Domain d2q4db_: 2q4d B: [139846]
    automated match to d1ydha_
    complexed with edo, no3

Details for d2q4db_

PDB Entry: 2q4d (more details), 2.15 Å

PDB Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At5g11950
PDB Compounds: (B:) Lysine decarboxylase-like protein At5g11950

SCOPe Domain Sequences for d2q4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4db_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyegglh
vlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeellemit
wsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekmeey
t

SCOPe Domain Coordinates for d2q4db_:

Click to download the PDB-style file with coordinates for d2q4db_.
(The format of our PDB-style files is described here.)

Timeline for d2q4db_: