SCOPe 2.07: Domain d2q4da_: 2q4d A:

Lineage for d2q4da_ (2q4d A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (3 families)

5. Family c.129.1.1: MoCo carrier protein-like [102406] (6 proteins)
   Pfam PF03641

6. Protein Hypothetical protein At5g11950 [117567] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117568] (2 PDB entries)
   Uniprot Q84MC2

8. Domain d2q4da_: 2q4d A: [139845]
   automated match to d1ydha_
   complexed with edo, no3

Details for d2q4da_

PDB Entry: 2q4d, 2.15 Å

PDB Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At5g11950

PDB Compounds: (A:) Lysine decarboxylase-like protein At5g11950

SCOPe Domain Sequences for d2q4da_:

Sequence; same for both SEQRES and ATOM records:

>d2q4da_ c.129.1.1 (A:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg
glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle
mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm
eeyt

Timeline for d2q4da_:

• d2q4da_ first appeared in SCOP 1.73, called d2q4da1
  
• d2q4da_ appears in SCOPe 2.06
  
• d2q4da_ appears in the current release, SCOPe 2.08