Lineage for d2q4ab1 (2q4a B:4-330)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677810Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (2 proteins)
    Pfam PF03322
  6. 677819Protein Clavaminate synthase-like protein At3g21360 [117321] (1 species)
  7. 677820Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117322] (2 PDB entries)
  8. 677824Domain d2q4ab1: 2q4a B:4-330 [139840]
    automatically matched to d1y0zb_
    complexed with fe, so4

Details for d2q4ab1

PDB Entry: 2q4a (more details), 2.39 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g21360
PDB Compounds: (B:) Clavaminate synthase-like protein At3g21360

SCOP Domain Sequences for d2q4ab1:

Sequence, based on SEQRES records: (download)

>d2q4ab1 b.82.2.8 (B:4-330) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesga
vlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhem
aqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlge
dddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrn
rkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdv
llidnwavlhsrrpfdpprrvlaslck

Sequence, based on observed residues (ATOM records): (download)

>d2q4ab1 b.82.2.8 (B:4-330) Clavaminate synthase-like protein At3g21360 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesga
vlfrgfpvnsaddfndvveafgfdelpytsvvgrvftanesppdqkipfhhemaqvrefp
sklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpssp
igrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwfns
mvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidnwa
vlhsrrpfdpprrvlaslck

SCOP Domain Coordinates for d2q4ab1:

Click to download the PDB-style file with coordinates for d2q4ab1.
(The format of our PDB-style files is described here.)

Timeline for d2q4ab1: