Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 proteins) Pfam PF03322 |
Protein automated matches [190356] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187185] (1 PDB entry) |
Domain d2q4aa_: 2q4a A: [139839] automated match to d1y0zb_ complexed with fe, so4 |
PDB Entry: 2q4a (more details), 2.39 Å
SCOPe Domain Sequences for d2q4aa_:
Sequence, based on SEQRES records: (download)
>d2q4aa_ b.82.2.8 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhesga vlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhem aqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlge dddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrn rkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdv llidnwavlhsrrpfdpprrvlaslck
>d2q4aa_ b.82.2.8 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lllvetpipqqkhyeskpfpavispppalslplftqtiktqkhyldsllhesgavlfrgf pvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhemaqvref psklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpss pigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwfn smvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidnw avlhsrrpfdpprrvlaslck
Timeline for d2q4aa_: