SCOPe 2.06: Domain d2q49d2: 2q49 D:163-326

Lineage for d2q49d2 (2q49 D:163-326)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118038] (2 PDB entries)
   Uniprot O82187 15-359

8. Domain d2q49d2: 2q49 D:163-326 [139838]
   Other proteins in same PDB: d2q49a1, d2q49b1, d2q49c1, d2q49d1
   automated match to d1xyga2

Details for d2q49d2

PDB Entry: 2q49, 2.19 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g19940

PDB Compounds: (D:) Probable N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d2q49d2:

Sequence; same for both SEQRES and ATOM records:

>d2q49d2 d.81.1.1 (D:163-326) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cypttiqlplvpllkanlikheniiidaksgvsgagrgakeanlyseiaegissygvtrh
rhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyed
eefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvid

Timeline for d2q49d2:

• d2q49d2 first appeared in SCOP 1.73
  
• d2q49d2 appears in SCOPe 2.05
  
• d2q49d2 appears in SCOPe 2.07
  
• d2q49d2 appears in the current release, SCOPe 2.08