Lineage for d2q49c1 (2q49 C:15-162,C:327-359)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687697Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)
  7. 687700Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries)
  8. 687707Domain d2q49c1: 2q49 C:15-162,C:327-359 [139835]
    Other proteins in same PDB: d2q49a2, d2q49b2, d2q49c2, d2q49d2
    automatically matched to d1xyga1

Details for d2q49c1

PDB Entry: 2q49 (more details), 2.19 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g19940
PDB Compounds: (C:) Probable N-acetyl-gamma-glutamyl-phosphate reductase

SCOP Domain Sequences for d2q49c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q49c1 c.2.1.3 (C:15-162,C:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp

SCOP Domain Coordinates for d2q49c1:

Click to download the PDB-style file with coordinates for d2q49c1.
(The format of our PDB-style files is described here.)

Timeline for d2q49c1: