Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118038] (2 PDB entries) Uniprot O82187 15-359 |
Domain d2q49a2: 2q49 A:163-326 [139832] Other proteins in same PDB: d2q49a1, d2q49b1, d2q49c1, d2q49d1 automatically matched to d1xyga2 |
PDB Entry: 2q49 (more details), 2.19 Å
SCOPe Domain Sequences for d2q49a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q49a2 d.81.1.1 (A:163-326) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} cypttiqlplvpllkanlikheniiidaksgvsgagrgakeanlyseiaegissygvtrh rhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyed eefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvid
Timeline for d2q49a2: