Lineage for d2q49a2 (2q49 A:163-326)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961960Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (3 species)
  7. 2961963Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118038] (2 PDB entries)
    Uniprot O82187 15-359
  8. 2961964Domain d2q49a2: 2q49 A:163-326 [139832]
    Other proteins in same PDB: d2q49a1, d2q49b1, d2q49c1, d2q49d1
    automated match to d1xyga2

Details for d2q49a2

PDB Entry: 2q49 (more details), 2.19 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g19940
PDB Compounds: (A:) Probable N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d2q49a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q49a2 d.81.1.1 (A:163-326) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cypttiqlplvpllkanlikheniiidaksgvsgagrgakeanlyseiaegissygvtrh
rhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyed
eefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvid

SCOPe Domain Coordinates for d2q49a2:

Click to download the PDB-style file with coordinates for d2q49a2.
(The format of our PDB-style files is described here.)

Timeline for d2q49a2: