SCOP 1.75: Domain d2q48b1: 2q48 B:22-154

Lineage for d2q48b1 (2q48 B:22-154)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.9: Hypothetical protein At5g48480 [117876] (1 protein)
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypothetical protein At5g48480 [117877] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117878] (2 PDB entries)
   Uniprot Q9LV66 20-154

8. Domain d2q48b1: 2q48 B:22-154 [139830]
   automatically matched to d1xy7a_

Details for d2q48b1

PDB Entry: 2q48, 1.8 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g48480

PDB Compounds: (B:) Protein At5g48480

SCOP Domain Sequences for d2q48b1:

Sequence, based on SEQRES records:

>d2q48b1 d.32.1.9 (B:22-154) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlagss
fvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgk
vtdpfgvtwifae

Sequence, based on observed residues (ATOM records):

>d2q48b1 d.32.1.9 (B:22-154) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vftefkqmllveaqkvgdavtfyksafgaiesghslhvlsselnlagssfvvcdvsslpg
fstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwif
ae

Timeline for d2q48b1:

• d2q48b1 first appeared in SCOP 1.73
  
• d2q48b1 is called d2q48b_ in SCOPe 2.01
  
• d2q48b1 appears in the current release, SCOPe 2.08, called d2q48b_