Lineage for d2q48a1 (2q48 A:20-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720941Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 720942Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 721222Family d.32.1.9: Hypothetical protein At5g48480 [117876] (1 protein)
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 721223Protein Hypothetical protein At5g48480 [117877] (1 species)
  7. 721224Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117878] (2 PDB entries)
  8. 721227Domain d2q48a1: 2q48 A:20-154 [139829]
    automatically matched to d1xy7a_

Details for d2q48a1

PDB Entry: 2q48 (more details), 1.8 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g48480
PDB Compounds: (A:) Protein At5g48480

SCOP Domain Sequences for d2q48a1:

Sequence, based on SEQRES records: (download)

>d2q48a1 d.32.1.9 (A:20-154) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlag
ssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfk
gkvtdpfgvtwifae

Sequence, based on observed residues (ATOM records): (download)

>d2q48a1 d.32.1.9 (A:20-154) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs
taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae

SCOP Domain Coordinates for d2q48a1:

Click to download the PDB-style file with coordinates for d2q48a1.
(The format of our PDB-style files is described here.)

Timeline for d2q48a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q48b1