Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.9: Hypothetical protein At5g48480 [117876] (2 proteins) subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein automated matches [190355] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187184] (1 PDB entry) |
Domain d2q48a_: 2q48 A: [139829] automated match to d1xy7a_ |
PDB Entry: 2q48 (more details), 1.8 Å
SCOPe Domain Sequences for d2q48a_:
Sequence, based on SEQRES records: (download)
>d2q48a_ d.32.1.9 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hlvftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlag ssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfk gkvtdpfgvtwifae
>d2q48a_ d.32.1.9 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae
Timeline for d2q48a_: