Lineage for d2q48a_ (2q48 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942865Family d.32.1.9: Hypothetical protein At5g48480 [117876] (2 proteins)
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942870Protein automated matches [190355] (1 species)
    not a true protein
  7. 2942871Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187184] (1 PDB entry)
  8. 2942872Domain d2q48a_: 2q48 A: [139829]
    automated match to d1xy7a_

Details for d2q48a_

PDB Entry: 2q48 (more details), 1.8 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g48480
PDB Compounds: (A:) Protein At5g48480

SCOPe Domain Sequences for d2q48a_:

Sequence, based on SEQRES records: (download)

>d2q48a_ d.32.1.9 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlag
ssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfk
gkvtdpfgvtwifae

Sequence, based on observed residues (ATOM records): (download)

>d2q48a_ d.32.1.9 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs
taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae

SCOPe Domain Coordinates for d2q48a_:

Click to download the PDB-style file with coordinates for d2q48a_.
(The format of our PDB-style files is described here.)

Timeline for d2q48a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q48b_