![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
![]() | Protein Putative phosphatase At1g05000 [117579] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries) Uniprot Q9ZVN4 52-201 |
![]() | Domain d2q47a1: 2q47 A:52-202 [139827] automatically matched to d1xria_ complexed with so4 |
PDB Entry: 2q47 (more details), 3.3 Å
SCOPe Domain Sequences for d2q47a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q47a1 c.45.1.1 (A:52-202) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc ltsifdeyqrfaaakarvsdqrfmeifdvss
Timeline for d2q47a1: