SCOP 1.73: Domain d2q45a1: 2q45 A:7-265

Lineage for d2q45a1 (2q45 A:7-265)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Tropinone reductase [51795] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117410] (2 PDB entries)

8. Domain d2q45a1: 2q45 A:7-265 [139824]
   automatically matched to d1xq1a_

Details for d2q45a1

PDB Entry: 2q45, 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of putative tropinone reductase from Arabidopsis thaliana gene At1g07440

PDB Compounds: (A:) Putative tropinone reductase homolog At1g07440

SCOP Domain Sequences for d2q45a1:

Sequence, based on SEQRES records:

>d2q45a1 c.2.1.2 (A:7-265) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
gsvcdaslrpereklmqtvssmfggkldilinnlgairskptldytaedfsfhistnles
ayhlsqlahpllkasgcgniifmssiagvvsasvgsiysatkgalnqlarnlacewasdg
iranavapaviatplaeavyddefkkvvisrkplgrfgepeevsslvaflcmpaasyitg
qticvdggltvngfsyqpq

Sequence, based on observed residues (ATOM records):

>d2q45a1 c.2.1.2 (A:7-265) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
gsvcdaslrpereklmqtvssmfggkldilinnlgaldytaedfsfhistnlesayhlsq
lahpllkasgcgniifmsgsiysatkgalnqlarnlacewasdgiranavapaviagepe
evsslvaflcmpaasyitgqticvdggltvngfsyqpq

Timeline for d2q45a1:

• d2q45a1 is new in SCOP 1.73
  
• d2q45a1 appears in SCOP 1.75
  
• d2q45a1 appears in the current release, SCOPe 2.08, called d2q45a_