SCOPe 2.08: Domain d2q43a2: 2q43 A:195-313

Lineage for d2q43a2 (2q43 A:195-313)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein IAA-amino acid hydrolase [117979] (1 species)
   apparently monomeric

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117980] (2 PDB entries)
   Uniprot P54970 37-428

8. Domain d2q43a2: 2q43 A:195-313 [139822]
   Other proteins in same PDB: d2q43a1
   automated match to d1xmba2

Details for d2q43a2

PDB Entry: 2q43, 2 Å

PDB Description: Ensemble refinement of the protein crystal structure of IAA-aminoacid hydrolase from Arabidopsis thaliana gene At5g56660

PDB Compounds: (A:) IAA-amino acid hydrolase ILR1-like 2

SCOPe Domain Sequences for d2q43a2:

Sequence, based on SEQRES records:

>d2q43a2 d.58.19.1 (A:195-313) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvng
gnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

Sequence, based on observed residues (ATOM records):

>d2q43a2 d.58.19.1 (A:195-313) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtl
raftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp

Timeline for d2q43a2:

• d2q43a2 first appeared in SCOP 1.73
  
• d2q43a2 appears in SCOPe 2.07