| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
| Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
| Protein IAA-amino acid hydrolase [117979] (1 species) apparently monomeric |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117980] (2 PDB entries) Uniprot P54970 37-428 |
| Domain d2q43a2: 2q43 A:195-313 [139822] Other proteins in same PDB: d2q43a1 automated match to d1xmba2 |
PDB Entry: 2q43 (more details), 2 Å
SCOPe Domain Sequences for d2q43a2:
Sequence, based on SEQRES records: (download)
>d2q43a2 d.58.19.1 (A:195-313) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvng
gnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp
>d2q43a2 d.58.19.1 (A:195-313) IAA-amino acid hydrolase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtl
raftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpp
Timeline for d2q43a2: