Lineage for d2q43a1 (2q43 A:16-194,A:314-407)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889724Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2889809Protein IAA-amino acid hydrolase, catalytic domain [117663] (1 species)
  7. 2889810Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117664] (2 PDB entries)
    Uniprot P54970 37-428
  8. 2889811Domain d2q43a1: 2q43 A:16-194,A:314-407 [139821]
    Other proteins in same PDB: d2q43a2
    automated match to d1xmba1

Details for d2q43a1

PDB Entry: 2q43 (more details), 2 Å

PDB Description: Ensemble refinement of the protein crystal structure of IAA-aminoacid hydrolase from Arabidopsis thaliana gene At5g56660
PDB Compounds: (A:) IAA-amino acid hydrolase ILR1-like 2

SCOPe Domain Sequences for d2q43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q43a1 c.56.5.4 (A:16-194,A:314-407) IAA-amino acid hydrolase, catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi
gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh
rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsflX
tvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghfsllgmqdetngya
sshsplyrinedvlpygaaihasmavqylkekas

SCOPe Domain Coordinates for d2q43a1:

Click to download the PDB-style file with coordinates for d2q43a1.
(The format of our PDB-style files is described here.)

Timeline for d2q43a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q43a2