![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
![]() | Protein IAA-amino acid hydrolase, catalytic domain [117663] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117664] (2 PDB entries) Uniprot P54970 37-428 |
![]() | Domain d2q43a1: 2q43 A:16-194,A:314-407 [139821] Other proteins in same PDB: d2q43a2 automated match to d1xmba1 |
PDB Entry: 2q43 (more details), 2 Å
SCOPe Domain Sequences for d2q43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q43a1 c.56.5.4 (A:16-194,A:314-407) IAA-amino acid hydrolase, catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsflX tvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghfsllgmqdetngya sshsplyrinedvlpygaaihasmavqylkekas
Timeline for d2q43a1: