Lineage for d2q42b_ (2q42 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224648Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)
  6. 1224649Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)
  7. 1224657Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)
    Uniprot Q9SID3
  8. 1224661Domain d2q42b_: 2q42 B: [139820]
    automated match to d1xm8a_
    complexed with acy, fe, peg, zn

Details for d2q42b_

PDB Entry: 2q42 (more details), 1.74 Å

PDB Description: Ensemble refinement of the protein crystal structure of glyoxalase II from Arabidopsis thaliana gene At2g31350
PDB Compounds: (B:) Putative hydroxyacylglutathione hydrolase 2

SCOPe Domain Sequences for d2q42b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q42b_ d.157.1.2 (B:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
aealgiirkakddf

SCOPe Domain Coordinates for d2q42b_:

Click to download the PDB-style file with coordinates for d2q42b_.
(The format of our PDB-style files is described here.)

Timeline for d2q42b_: