SCOP 1.73: Domain d2q42b1: 2q42 B:1-254

Lineage for d2q42b1 (2q42 B:1-254)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families)

5. Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)

6. Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)

8. Domain d2q42b1: 2q42 B:1-254 [139820]
   automatically matched to d1xm8a_
   complexed with acy, fe, peg, zn

Details for d2q42b1

PDB Entry: 2q42, 1.74 Å

PDB Description: Ensemble refinement of the protein crystal structure of glyoxalase II from Arabidopsis thaliana gene At2g31350

PDB Compounds: (B:) Putative hydroxyacylglutathione hydrolase 2

SCOP Domain Sequences for d2q42b1:

Sequence; same for both SEQRES and ATOM records:

>d2q42b1 d.157.1.2 (B:1-254) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
aealgiirkakddf

Timeline for d2q42b1:

• d2q42b1 is new in SCOP 1.73
  
• d2q42b1 appears in SCOP 1.75
  
• d2q42b1 appears in the current release, SCOPe 2.08, called d2q42b2