SCOPe 2.08: Domain d2q42b2: 2q42 B:2-254

Lineage for d2q42b2 (2q42 B:2-254)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)

6. Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)
   Uniprot Q9SID3

8. Domain d2q42b2: 2q42 B:2-254 [139820]
   Other proteins in same PDB: d2q42a3, d2q42b3
   automated match to d1xm8a_
   complexed with acy, fe, peg, zn

Details for d2q42b2

PDB Entry: 2q42, 1.74 Å

PDB Description: Ensemble refinement of the protein crystal structure of glyoxalase II from Arabidopsis thaliana gene At2g31350

PDB Compounds: (B:) Putative hydroxyacylglutathione hydrolase 2

SCOPe Domain Sequences for d2q42b2:

Sequence; same for both SEQRES and ATOM records:

>d2q42b2 d.157.1.2 (B:2-254) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydhtg
gnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghislyf
pgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfals
lepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaadea
ealgiirkakddf

Timeline for d2q42b2:

• d2q42b2 first appeared in SCOP 1.73, called d2q42b1
  
• d2q42b2 appears in SCOPe 2.07