![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein) |
![]() | Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries) Uniprot Q9SID3 |
![]() | Domain d2q42a2: 2q42 A:2-254 [139819] Other proteins in same PDB: d2q42a3, d2q42b3 automated match to d1xm8a_ complexed with acy, fe, peg, zn |
PDB Entry: 2q42 (more details), 1.74 Å
SCOPe Domain Sequences for d2q42a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q42a2 d.157.1.2 (A:2-254) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydhtg gnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghislyf pgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfals lepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaadea ealgiirkakddf
Timeline for d2q42a2: