Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.17: Spermidine synthase [69557] (3 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein Spermidine synthase [69558] (6 species) polyamine aminopropyltransferase |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (2 PDB entries) Uniprot Q9ZUB3 |
Domain d2q41c_: 2q41 C: [139817] automated match to d1xj5a_ |
PDB Entry: 2q41 (more details), 2.7 Å
SCOPe Domain Sequences for d2q41c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q41c_ c.66.1.17 (C:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
Timeline for d2q41c_: