SCOP 1.73: Domain d2q41c1: 2q41 C:41-330

Lineage for d2q41c1 (2q41 C:41-330)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein Spermidine synthase [69558] (6 species)
   polyamine aminopropyltransferase

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (2 PDB entries)

8. Domain d2q41c1: 2q41 C:41-330 [139817]
   automatically matched to d1xj5b_

Details for d2q41c1

PDB Entry: 2q41, 2.7 Å

PDB Description: Ensemble refinement of the protein crystal structure of spermidine synthase from Arabidopsis thaliana gene At1g23820

PDB Compounds: (C:) Spermidine synthase 1

SCOP Domain Sequences for d2q41c1:

Sequence; same for both SEQRES and ATOM records:

>d2q41c1 c.66.1.17 (C:41-330) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie

Timeline for d2q41c1:

• d2q41c1 is new in SCOP 1.73
  
• d2q41c1 appears in SCOP 1.75
  
• d2q41c1 appears in the current release, SCOPe 2.08, called d2q41c_