![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.17: Spermidine synthase [69557] (2 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
![]() | Protein Spermidine synthase [69558] (6 species) polyamine aminopropyltransferase |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (2 PDB entries) |
![]() | Domain d2q41c1: 2q41 C:41-330 [139817] automatically matched to d1xj5b_ |
PDB Entry: 2q41 (more details), 2.7 Å
SCOP Domain Sequences for d2q41c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q41c1 c.66.1.17 (C:41-330) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
Timeline for d2q41c1: