Lineage for d2q41a1 (2q41 A:41-330)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704785Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 704790Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 704808Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (2 PDB entries)
  8. 704813Domain d2q41a1: 2q41 A:41-330 [139815]
    automatically matched to d1xj5b_

Details for d2q41a1

PDB Entry: 2q41 (more details), 2.7 Å

PDB Description: Ensemble refinement of the protein crystal structure of spermidine synthase from Arabidopsis thaliana gene At1g23820
PDB Compounds: (A:) Spermidine synthase 1

SCOP Domain Sequences for d2q41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q41a1 c.66.1.17 (A:41-330) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie

SCOP Domain Coordinates for d2q41a1:

Click to download the PDB-style file with coordinates for d2q41a1.
(The format of our PDB-style files is described here.)

Timeline for d2q41a1: