Lineage for d2q3wa1 (2q3w A:2-110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664899Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 664900Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 664901Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 664963Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species)
  7. 664964Species Pseudomonas mendocina [TaxId:300] [110155] (3 PDB entries)
  8. 664966Domain d2q3wa1: 2q3w A:2-110 [139813]
    automatically matched to d1vm9a_
    complexed with edo, fes, mg; mutant

Details for d2q3wa1

PDB Entry: 2q3w (more details), 1.48 Å

PDB Description: Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2Fe-2S] ferredoxin subunit of toluene-4-monooxygenase from Pseudomonas mendocina KR1
PDB Compounds: (A:) Toluene-4-monooxygenase system ferredoxin subunit

SCOP Domain Sequences for d2q3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3wa1 b.33.1.1 (A:2-110) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]}
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka

SCOP Domain Coordinates for d2q3wa1:

Click to download the PDB-style file with coordinates for d2q3wa1.
(The format of our PDB-style files is described here.)

Timeline for d2q3wa1: