![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species) |
![]() | Species Pseudomonas mendocina [TaxId:300] [110155] (5 PDB entries) Uniprot Q00458 |
![]() | Domain d2q3wa_: 2q3w A: [139813] automated match to d1sjga_ complexed with edo, fes, mg; mutant |
PDB Entry: 2q3w (more details), 1.48 Å
SCOPe Domain Sequences for d2q3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3wa_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka
Timeline for d2q3wa_: