Lineage for d2q3vb_ (2q3v B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200050Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2200089Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins)
  6. 2200094Protein automated matches [190354] (1 species)
    not a true protein
  7. 2200095Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187182] (1 PDB entry)
  8. 2200097Domain d2q3vb_: 2q3v B: [139812]
    automated match to d1vm0b_
    complexed with k, no3

Details for d2q3vb_

PDB Entry: 2q3v (more details), 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160
PDB Compounds: (B:) Protein At2g34160

SCOPe Domain Sequences for d2q3vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3vb_ d.68.6.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke

SCOPe Domain Coordinates for d2q3vb_:

Click to download the PDB-style file with coordinates for d2q3vb_.
(The format of our PDB-style files is described here.)

Timeline for d2q3vb_: