SCOP 1.75: Domain d2q3vb1: 2q3v B:20-117

Lineage for d2q3vb1 (2q3v B:20-117)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (2 families)

5. Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein)

6. Protein Hypothetical protein At2g34160 [111028] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries)
   Uniprot O22969 19-117

8. Domain d2q3vb1: 2q3v B:20-117 [139812]
   automatically matched to d1vm0b_
   complexed with k, no3; mutant

Details for d2q3vb1

PDB Entry: 2q3v, 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160

PDB Compounds: (B:) Protein At2g34160

SCOP Domain Sequences for d2q3vb1:

Sequence; same for both SEQRES and ATOM records:

>d2q3vb1 d.68.6.2 (B:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaa

Timeline for d2q3vb1:

• d2q3vb1 first appeared in SCOP 1.73
  
• d2q3vb1 is called d2q3vb_ in SCOPe 2.01
  
• d2q3vb1 appears in the current release, SCOPe 2.08, called d2q3vb_