Lineage for d2q3vb1 (2q3v B:20-117)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726672Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 726694Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein)
  6. 726695Protein Hypothetical protein At2g34160 [111028] (1 species)
  7. 726696Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries)
  8. 726700Domain d2q3vb1: 2q3v B:20-117 [139812]
    automatically matched to d1vm0b_
    complexed with k, no3; mutant

Details for d2q3vb1

PDB Entry: 2q3v (more details), 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160
PDB Compounds: (B:) Protein At2g34160

SCOP Domain Sequences for d2q3vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3vb1 d.68.6.2 (B:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaa

SCOP Domain Coordinates for d2q3vb1:

Click to download the PDB-style file with coordinates for d2q3vb1.
(The format of our PDB-style files is described here.)

Timeline for d2q3vb1: