| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
| Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins) |
| Protein automated matches [190354] (1 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187182] (1 PDB entry) |
| Domain d2q3vb_: 2q3v B: [139812] automated match to d1vm0b_ complexed with k, no3 |
PDB Entry: 2q3v (more details), 1.8 Å
SCOPe Domain Sequences for d2q3vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3vb_ d.68.6.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke
Timeline for d2q3vb_: