SCOPe 2.08: Domain d2q3vb_: 2q3v B:

Lineage for d2q3vb_ (2q3v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins)

6. Protein automated matches [190354] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187182] (1 PDB entry)

8. Domain d2q3vb_: 2q3v B: [139812]
   automated match to d1vm0b_
   complexed with k, no3

Details for d2q3vb_

PDB Entry: 2q3v, 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160

PDB Compounds: (B:) Protein At2g34160

SCOPe Domain Sequences for d2q3vb_:

Sequence; same for both SEQRES and ATOM records:

>d2q3vb_ d.68.6.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke

Timeline for d2q3vb_:

• d2q3vb_ first appeared in SCOP 1.73, called d2q3vb1
  
• d2q3vb_ appears in SCOPe 2.07