![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
![]() | Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins) |
![]() | Protein automated matches [190354] (1 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187182] (1 PDB entry) |
![]() | Domain d2q3va_: 2q3v A: [139811] automated match to d1vm0b_ complexed with k, no3 |
PDB Entry: 2q3v (more details), 1.8 Å
SCOPe Domain Sequences for d2q3va_:
Sequence, based on SEQRES records: (download)
>d2q3va_ d.68.6.2 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk imtsivdikddargrpvqkakieitlvksekfdelmaaa
>d2q3va_ d.68.6.2 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk imtsivdikpvqkakieitlvksekfdelmaaa
Timeline for d2q3va_: