![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (2 families) ![]() |
![]() | Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein) |
![]() | Protein Hypothetical protein At2g34160 [111028] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries) |
![]() | Domain d2q3va1: 2q3v A:20-117 [139811] automatically matched to d1vm0b_ complexed with k, no3; mutant |
PDB Entry: 2q3v (more details), 1.8 Å
SCOP Domain Sequences for d2q3va1:
Sequence, based on SEQRES records: (download)
>d2q3va1 d.68.6.2 (A:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki mtsivdikddargrpvqkakieitlvksekfdelmaaa
>d2q3va1 d.68.6.2 (A:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki mtsivdikpvqkakieitlvksekfdelmaaa
Timeline for d2q3va1: