SCOP 1.73: Domain d2q3va1: 2q3v A:20-117

Lineage for d2q3va1 (2q3v A:20-117)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (2 families)

5. Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein)

6. Protein Hypothetical protein At2g34160 [111028] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries)

8. Domain d2q3va1: 2q3v A:20-117 [139811]
   automatically matched to d1vm0b_
   complexed with k, no3; mutant

Details for d2q3va1

PDB Entry: 2q3v, 1.8 Å

PDB Description: ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160

PDB Compounds: (A:) Protein At2g34160

SCOP Domain Sequences for d2q3va1:

Sequence, based on SEQRES records:

>d2q3va1 d.68.6.2 (A:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikddargrpvqkakieitlvksekfdelmaaa

Sequence, based on observed residues (ATOM records):

>d2q3va1 d.68.6.2 (A:20-117) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
mtsivdikpvqkakieitlvksekfdelmaaa

Timeline for d2q3va1:

• d2q3va1 is new in SCOP 1.73
  
• d2q3va1 appears in SCOP 1.75
  
• d2q3va1 appears in the current release, SCOPe 2.08, called d2q3va_