Lineage for d2q3ta1 (2q3t A:36-156)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651412Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily)
    5 helices; array; probable biological unit is a homodimer
  4. 651413Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) (S)
  5. 651414Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein)
  6. 651415Protein Hypothetical protein At3g22680 [109922] (1 species)
  7. 651416Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [109923] (2 PDB entries)
  8. 651418Domain d2q3ta1: 2q3t A:36-156 [139808]
    automatically matched to d1vk5a_
    complexed with cps, edo, so4

Details for d2q3ta1

PDB Entry: 2q3t (more details), 1.6 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680
PDB Compounds: (A:) Protein At3g22680

SCOP Domain Sequences for d2q3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3ta1 a.220.1.1 (A:36-156) Hypothetical protein At3g22680 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq
srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp
e

SCOP Domain Coordinates for d2q3ta1:

Click to download the PDB-style file with coordinates for d2q3ta1.
(The format of our PDB-style files is described here.)

Timeline for d2q3ta1: