![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily) 5 helices; array; probable biological unit is a homodimer |
![]() | Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) ![]() |
![]() | Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein) |
![]() | Protein Hypothetical protein At3g22680 [109922] (1 species) |
![]() | Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [109923] (2 PDB entries) |
![]() | Domain d2q3ta1: 2q3t A:36-156 [139808] automatically matched to d1vk5a_ complexed with cps, edo, so4 |
PDB Entry: 2q3t (more details), 1.6 Å
SCOP Domain Sequences for d2q3ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3ta1 a.220.1.1 (A:36-156) Hypothetical protein At3g22680 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp e
Timeline for d2q3ta1: