Class a: All alpha proteins [46456] (290 folds) |
Fold a.220: Hypothetical protein At3g22680 [109919] (1 superfamily) 5 helices; array; probable biological unit is a homodimer |
Superfamily a.220.1: Hypothetical protein At3g22680 [109920] (1 family) automatically mapped to Pfam PF09187 |
Family a.220.1.1: Hypothetical protein At3g22680 [109921] (1 protein) |
Protein Hypothetical protein At3g22680 [109922] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109923] (3 PDB entries) Uniprot Q9LUJ3 |
Domain d2q3ta_: 2q3t A: [139808] automated match to d1vk5a_ complexed with cps, edo, so4 |
PDB Entry: 2q3t (more details), 1.6 Å
SCOPe Domain Sequences for d2q3ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3ta_ a.220.1.1 (A:) Hypothetical protein At3g22680 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp e
Timeline for d2q3ta_: