Lineage for d2q3se1 (2q3s E:1-206)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837032Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
    contains Pfam PF00929
  6. 837219Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 837220Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)
  8. 837231Domain d2q3se1: 2q3s E:1-206 [139806]
    automatically matched to d1vk0a_

Details for d2q3se1

PDB Entry: 2q3s (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g06450
PDB Compounds: (E:) Protein At5g06450

SCOP Domain Sequences for d2q3se1:

Sequence, based on SEQRES records: (download)

>d2q3se1 c.55.3.5 (E:1-206) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
gpeeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d2q3se1 c.55.3.5 (E:1-206) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
eaaaiegwlivnvwdqlsde

SCOP Domain Coordinates for d2q3se1:

Click to download the PDB-style file with coordinates for d2q3se1.
(The format of our PDB-style files is described here.)

Timeline for d2q3se1: