Lineage for d2q3ra1 (2q3r A:9-369)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681637Protein 12-oxophytodienoate reductase (OPR, OYE homolog) [63896] (3 species)
  7. 681638Species Thale cress (Arabidopsis thaliana), OPR1 [TaxId:3702] [102040] (2 PDB entries)
    At1G76680
  8. 681640Domain d2q3ra1: 2q3r A:9-369 [139801]
    automatically matched to d1vjia_
    complexed with fmn

Details for d2q3ra1

PDB Entry: 2q3r (more details), 2 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g76680 from Arabidopsis thaliana
PDB Compounds: (A:) 12-oxophytodienoate reductase 1

SCOP Domain Sequences for d2q3ra1:

Sequence, based on SEQRES records: (download)

>d2q3ra1 c.1.4.1 (A:9-369) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR1 [TaxId: 3702]}
svplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvs
dtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapisc
sdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangy
lidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfadymesgdt
npgalglymaeslnkygilychviearmktmgevhacphtlmpmrkafkgtfisaggftr
edgneavskgrtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvvgytdypfl
e

Sequence, based on observed residues (ATOM records): (download)

>d2q3ra1 c.1.4.1 (A:9-369) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR1 [TaxId: 3702]}
svplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvs
dtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapisc
sdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangy
lidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfadymesgdt
npgalglymaeslnkygilychviearmhtlmpmrkafkgtfisaggftredgneavskg
rtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvvgytdypfle

SCOP Domain Coordinates for d2q3ra1:

Click to download the PDB-style file with coordinates for d2q3ra1.
(The format of our PDB-style files is described here.)

Timeline for d2q3ra1: