Lineage for d2q3qb_ (2q3q B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926374Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1926375Protein Hypothetical protein At1G24000 [103251] (1 species)
  7. 1926376Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)
  8. 1926378Domain d2q3qb_: 2q3q B: [139800]
    automated match to d1vjha_

Details for d2q3qb_

PDB Entry: 2q3q (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g24000 from Arabidopsis thaliana
PDB Compounds: (B:) Uncharacterized protein At1g24000

SCOPe Domain Sequences for d2q3qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3qb_ d.129.3.1 (B:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

SCOPe Domain Coordinates for d2q3qb_:

Click to download the PDB-style file with coordinates for d2q3qb_.
(The format of our PDB-style files is described here.)

Timeline for d2q3qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q3qa_