Lineage for d2q3qb1 (2q3q B:1-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733463Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 733464Protein Hypothetical protein At1G24000 [103251] (1 species)
  7. 733465Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)
  8. 733469Domain d2q3qb1: 2q3q B:1-120 [139800]
    automatically matched to d1vjha_

Details for d2q3qb1

PDB Entry: 2q3q (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g24000 from Arabidopsis thaliana
PDB Compounds: (B:) Uncharacterized protein At1g24000

SCOP Domain Sequences for d2q3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3qb1 d.129.3.1 (B:1-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

SCOP Domain Coordinates for d2q3qb1:

Click to download the PDB-style file with coordinates for d2q3qb1.
(The format of our PDB-style files is described here.)

Timeline for d2q3qb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q3qa1