SCOPe 2.06: Domain d2q3qa2: 2q3q A:2-120

Lineage for d2q3qa2 (2q3q A:2-120)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Hypothetical protein At1G24000 [103251] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)

8. Domain d2q3qa2: 2q3q A:2-120 [139799]
   Other proteins in same PDB: d2q3qa3, d2q3qb3
   automated match to d1vjha_

Details for d2q3qa2

PDB Entry: 2q3q, 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g24000 from Arabidopsis thaliana

PDB Compounds: (A:) Uncharacterized protein At1g24000

SCOPe Domain Sequences for d2q3qa2:

Sequence; same for both SEQRES and ATOM records:

>d2q3qa2 d.129.3.1 (A:2-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqk
yfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

Timeline for d2q3qa2:

• d2q3qa2 first appeared in SCOP 1.73, called d2q3qa1
  
• d2q3qa2 was called d2q3qa_ in SCOPe 2.05
  
• d2q3qa2 appears in SCOPe 2.07
  
• d2q3qa2 appears in the current release, SCOPe 2.08