SCOP 1.73: Domain d2q3qa1: 2q3q A:1-120

Lineage for d2q3qa1 (2q3q A:1-120)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)

6. Protein Hypothetical protein At1G24000 [103251] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)

8. Domain d2q3qa1: 2q3q A:1-120 [139799]
   automatically matched to d1vjha_

Details for d2q3qa1

PDB Entry: 2q3q, 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g24000 from Arabidopsis thaliana

PDB Compounds: (A:) Uncharacterized protein At1g24000

SCOP Domain Sequences for d2q3qa1:

Sequence; same for both SEQRES and ATOM records:

>d2q3qa1 d.129.3.1 (A:1-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

Timeline for d2q3qa1:

• d2q3qa1 is new in SCOP 1.73
  
• d2q3qa1 appears in SCOP 1.75
  
• d2q3qa1 appears in the current release, SCOPe 2.08, called d2q3qa2