![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins) |
![]() | Protein Hypothetical protein At1G24000 [103251] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries) |
![]() | Domain d2q3qa1: 2q3q A:1-120 [139799] automatically matched to d1vjha_ |
PDB Entry: 2q3q (more details), 2.1 Å
SCOP Domain Sequences for d2q3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3qa1 d.129.3.1 (A:1-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
Timeline for d2q3qa1: