Lineage for d2q3qa2 (2q3q A:2-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975506Protein Hypothetical protein At1G24000 [103251] (1 species)
  7. 2975507Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [103252] (2 PDB entries)
  8. 2975508Domain d2q3qa2: 2q3q A:2-120 [139799]
    Other proteins in same PDB: d2q3qa3, d2q3qb3
    automated match to d1vjha_

Details for d2q3qa2

PDB Entry: 2q3q (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of At1g24000 from Arabidopsis thaliana
PDB Compounds: (A:) Uncharacterized protein At1g24000

SCOPe Domain Sequences for d2q3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3qa2 d.129.3.1 (A:2-120) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqk
yfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf

SCOPe Domain Coordinates for d2q3qa2:

Click to download the PDB-style file with coordinates for d2q3qa2.
(The format of our PDB-style files is described here.)

Timeline for d2q3qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q3qa3