Lineage for d2q3pa_ (2q3p A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517213Family d.58.4.4: Plant stress-induced protein [89927] (3 protein domains)
    automatically mapped to Pfam PF07876
  6. 2517243Protein Hypothetical protein AT3G17210.1 [89928] (1 species)
  7. 2517244Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (4 PDB entries)
  8. 2517245Domain d2q3pa_: 2q3p A: [139798]
    automated match to d1q53a_
    complexed with mg

Details for d2q3pa_

PDB Entry: 2q3p (more details), 1.9 Å

PDB Description: Ensemble refinement of the protein crystal structure of At3g17210 from Arabidopsis thaliana
PDB Compounds: (A:) Uncharacterized protein At3g17210

SCOPe Domain Sequences for d2q3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3pa_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

SCOPe Domain Coordinates for d2q3pa_:

Click to download the PDB-style file with coordinates for d2q3pa_.
(The format of our PDB-style files is described here.)

Timeline for d2q3pa_: