Lineage for d2q3oa_ (2q3o A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080485Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187180] (2 PDB entries)
  8. 2080486Domain d2q3oa_: 2q3o A: [139796]
    automated match to d1q45a_
    complexed with fmn

Details for d2q3oa_

PDB Entry: 2q3o (more details), 2 Å

PDB Description: Ensemble refinement of the protein crystal structure of 12-oxo-phytodienoate reductase isoform 3
PDB Compounds: (A:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d2q3oa_:

Sequence, based on SEQRES records: (download)

>d2q3oa_ c.1.4.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
snetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmv
spgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspis
stnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihg
ahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhld
atdsdplslglavvgmlnklqgvngsklaylhvtqpryhaygqtesgrqgsdeeeaklmk
slrmayngtfmssggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynr
ktfytqdpvvgytdypflap

Sequence, based on observed residues (ATOM records): (download)

>d2q3oa_ c.1.4.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
snetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmv
spgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspis
stnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihg
ahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhld
atdsdplslglavvgmlnklqgvngsklaylhvtqpreeeaklmkslrmayngtfmssgg
fnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrktfytqdpvvgytdy
pflap

SCOPe Domain Coordinates for d2q3oa_:

Click to download the PDB-style file with coordinates for d2q3oa_.
(The format of our PDB-style files is described here.)

Timeline for d2q3oa_: