Lineage for d2q3ma_ (2q3m A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109987Protein automated matches [190189] (4 species)
    not a true protein
  7. 2110024Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187179] (1 PDB entry)
  8. 2110025Domain d2q3ma_: 2q3m A: [139795]
    automated match to d1q44a_
    complexed with mla

Details for d2q3ma_

PDB Entry: 2q3m (more details), 1.9 Å

PDB Description: ensemble refinement of the protein crystal structure of an arabidopsis thaliana putative steroid sulphotransferase
PDB Compounds: (A:) Flavonol sulfotransferase-like

SCOPe Domain Sequences for d2q3ma_:

Sequence, based on SEQRES records: (download)

>d2q3ma_ c.37.1.5 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklapeetad
ypiekaveafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaef
lecgfieeeevreivklcsfeslsnlevnkegklpngietktffrkgeiggwrdtlsesl
aeeidrtieekfkgsglkfs

Sequence, based on observed residues (ATOM records): (download)

>d2q3ma_ c.37.1.5 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklypiekav
eafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaeflecgfie
eeevreivklcsfegwrdtlseslaeeidrtieekfkgsglkfs

SCOPe Domain Coordinates for d2q3ma_:

Click to download the PDB-style file with coordinates for d2q3ma_.
(The format of our PDB-style files is described here.)

Timeline for d2q3ma_: