Lineage for d2q3ia1 (2q3i A:1-45)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 895965Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 895966Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 896012Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 896013Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (22 PDB entries)
  8. 896019Domain d2q3ia1: 2q3i A:1-45 [139794]
    automatically matched to d1czqa_

Details for d2q3ia1

PDB Entry: 2q3i (more details), 1.5 Å

PDB Description: Crystal structure of the D10-P3/IQN17 complex: a D-peptide inhibitor of HIV-1 entry bound to the GP41 coiled-coil pocket
PDB Compounds: (A:) Fusion protein between the Coiled-Coil pocket of HIV GP41 and gcn4-PIQI

SCOP Domain Sequences for d2q3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3ia1 h.3.2.1 (A:1-45) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril

SCOP Domain Coordinates for d2q3ia1:

Click to download the PDB-style file with coordinates for d2q3ia1.
(The format of our PDB-style files is described here.)

Timeline for d2q3ia1: