Lineage for d2q0aa_ (2q0a A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808276Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1808363Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 1808364Species Mouse (Mus musculus) [TaxId:10090] [101994] (5 PDB entries)
  8. 1808374Domain d2q0aa_: 2q0a A: [139781]
    automated match to d1q5oa_
    complexed with pcg

Details for d2q0aa_

PDB Entry: 2q0a (more details), 2.25 Å

PDB Description: structure and rearrangements in the carboxy-terminal region of spih channels
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d2q0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q0aa_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrd

SCOPe Domain Coordinates for d2q0aa_:

Click to download the PDB-style file with coordinates for d2q0aa_.
(The format of our PDB-style files is described here.)

Timeline for d2q0aa_: