SCOPe 2.08: Domain d2q0aa_: 2q0a A:

Lineage for d2q0aa_ (2q0a A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein HCN pacemaker channel [101993] (1 species)
   potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel

7. Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries)

8. Domain d2q0aa_: 2q0a A: [139781]
   automated match to d1q5oa_
   complexed with pcg

Details for d2q0aa_

PDB Entry: 2q0a, 2.25 Å

PDB Description: structure and rearrangements in the carboxy-terminal region of spih channels

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d2q0aa_:

Sequence; same for both SEQRES and ATOM records:

>d2q0aa_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrd

Timeline for d2q0aa_:

• d2q0aa_ first appeared in SCOP 1.73, called d2q0aa1
  
• d2q0aa_ appears in SCOPe 2.07