Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein HCN pacemaker channel [101993] (1 species) potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel |
Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries) |
Domain d2q0aa_: 2q0a A: [139781] automated match to d1q5oa_ complexed with pcg |
PDB Entry: 2q0a (more details), 2.25 Å
SCOPe Domain Sequences for d2q0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q0aa_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr rafetvaidrldrd
Timeline for d2q0aa_: