![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
![]() | Protein Poly(RC)-binding protein 2 [143220] (1 species) contains three KH domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries) Uniprot Q15366 11-81 |
![]() | Domain d2py9b_: 2py9 B: [139777] Other proteins in same PDB: d2py9a3 automated match to d2axya1 protein/DNA complex; protein/RNA complex |
PDB Entry: 2py9 (more details), 2.56 Å
SCOPe Domain Sequences for d2py9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py9b_ d.51.1.1 (B:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf amiidklee
Timeline for d2py9b_:
![]() Domains from other chains: (mouse over for more information) d2py9a2, d2py9a3, d2py9c_, d2py9d_ |