Lineage for d2py9b_ (2py9 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553974Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2553975Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2553976Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2554024Protein Poly(RC)-binding protein 2 [143220] (1 species)
    contains three KH domains
  7. 2554025Species Human (Homo sapiens) [TaxId:9606] [143221] (5 PDB entries)
    Uniprot Q15366 11-81
  8. 2554036Domain d2py9b_: 2py9 B: [139777]
    Other proteins in same PDB: d2py9a3
    automated match to d2axya1
    protein/DNA complex; protein/RNA complex

Details for d2py9b_

PDB Entry: 2py9 (more details), 2.56 Å

PDB Description: Protein-RNA Interaction involving KH1 domain from Human Poly(C)-Binding Protein-2
PDB Compounds: (B:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2py9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py9b_ d.51.1.1 (B:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf
amiidklee

SCOPe Domain Coordinates for d2py9b_:

Click to download the PDB-style file with coordinates for d2py9b_.
(The format of our PDB-style files is described here.)

Timeline for d2py9b_: