SCOPe 2.01: Domain d2py9b_: 2py9 B:

Lineage for d2py9b_ (2py9 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
   an RNA-binding domain

6. Protein Poly(RC)-binding protein 2 [143220] (1 species)
   contains three KH domains

7. Species Human (Homo sapiens) [TaxId:9606] [143221] (4 PDB entries)
   Uniprot Q15366 11-81

8. Domain d2py9b_: 2py9 B: [139777]
   automated match to d2axya1
   protein/DNA complex; protein/RNA complex

Details for d2py9b_

PDB Entry: 2py9, 2.56 Å

PDB Description: Protein-RNA Interaction involving KH1 domain from Human Poly(C)-Binding Protein-2

PDB Compounds: (B:) Poly(rC)-binding protein 2

SCOPe Domain Sequences for d2py9b_:

Sequence; same for both SEQRES and ATOM records:

>d2py9b_ d.51.1.1 (B:) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
tltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifkaf
amiidklee

Timeline for d2py9b_:

• d2py9b_ first appeared in SCOP 1.73, called d2py9b1
  
• d2py9b_ was called d2py9b1 in SCOP 1.75
  
• d2py9b_ appears in SCOPe 2.02
  
• d2py9b_ appears in the current release, SCOPe 2.08