SCOP 1.73: Domain d2py4a1: 2py4 A:2-144

Lineage for d2py4a1 (2py4 A:2-144)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d2py4a1: 2py4 A:2-144 [139775]
   automatically matched to d1sixa_
   complexed with dup, mg, trs

Details for d2py4a1

PDB Entry: 2py4, 1.49 Å

PDB Description: Full length structure of the Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP.

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d2py4a1:

Sequence; same for both SEQRES and ATOM records:

>d2py4a1 b.85.4.1 (A:2-144) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfdeaglastsrgdgg

Timeline for d2py4a1:

• d2py4a1 is new in SCOP 1.73
  
• d2py4a1 appears in SCOP 1.75
  
• d2py4a1 appears in the current release, SCOPe 2.08, called d2py4a_